General Information

  • ID:  hor004645
  • Uniprot ID:  Q4PSX1(24-107)
  • Protein name:  CLAVATA3/ESR (CLE)-related protein 10
  • Gene name:  CLE10
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  [CLE10p]: Expressed in stems, apex, leaves, flowers, siliques and pollen.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0033612 receptor serine/threonine kinase binding
  • GO BP:  GO:0010078 maintenance of root meristem identity; GO:0010088 phloem development; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0045595 regulation of cell differentiation
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  ATRNWTNRTHRTVPKVQHAYYAYPHRSCESFSRPYARSMCIELERIHRSSRQPLFSPPPPPTEIDQRYGVEKRLVPSGPNPLHN
  • Length:  84(24-107)
  • Propeptide:  MKTNRNRPINILIVFFLLTTARAATRNWTNRTHRTVPKVQHAYYAYPHRSCESFSRPYARSMCIELERIHRSSRQPLFSPPPPPTEIDQRYGVEKRLVPSGPNPLHN
  • Signal peptide:  MKTNRNRPINILIVFFLLTTARA
  • Modification:  T76 Hydroxyproline;T79 Hydroxyproline
  • Glycosylation:  T4 N-linked (GlcNAc...) asparagine;T7 N-linked (GlcNAc...) asparagine;T79 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  NA

Activity

  • Function:  Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q4PSX1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004645_AF2.pdbhor004645_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 1134868 Formula: C435H671N137O122S3
Absent amino acids: Common amino acids: PR
pI: 10.41 Basic residues: 18
Polar residues: 26 Hydrophobic residues: 18
Hydrophobicity: -108.21 Boman Index: -25230
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 51.07
Instability Index: 8674.17 Extinction Coefficient cystines: 13075
Absorbance 280nm: 157.53

Literature

  • PubMed ID:  NA
  • Title:  NA