HORDB

ID: hor004645
Uniprot ID: Q4PSX1
Protein name: CLAVATA3/ESR (CLE)-related protein 10
Gene name: CLE10
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: [CLE10p]: Expressed in stems, apex, leaves, flowers, siliques and pollen.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0010078 maintenance of root meristem identity; GO:0010088 phloem development; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0045595 regulation of cell differentiation
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: ATRNWTNRTHRTVPKVQHAYYAYPHRSCESFSRPYARSMCIELERIHRSSRQPLFSPPPPPTEIDQRYGVEKRLVPSGPNPLHN
Length: 84
Propeptide: MKTNRNRPINILIVFFLLTTARAATRNWTNRTHRTVPKVQHAYYAYPHRSCESFSRPYARSMCIELERIHRSSRQPLFSPPPPPTEIDQRYGVEKRLVPSGPNPLHN
Signal peptide: MKTNRNRPINILIVFFLLTTARA
Modification: T76 Hydroxyproline;T79 Hydroxyproline
Glycosylation: T4 N-linked (GlcNAc...) asparagine;T7 N-linked (GlcNAc...) asparagine;T79 O-linked (Ara...) hydroxyproline
Mutagenesis: NA

Function: Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004645_AF2.pdb

hor004645_ESM.pdb

Mass:	1134868	Formula:	C435H671N137O122S3
Absent amino acids:		Common amino acids:	PR
pI:	10.41	Basic residues:	18
Polar residues:	26	Hydrophobic residues:	18
Hydrophobicity:	-108.21	Boman Index:	-25230
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	51.07
Instability Index:	8674.17	Extinction Coefficient cystines:	13075
Absorbance 280nm:	157.53